PTM Viewer PTM Viewer

AT5G09630.1

Arabidopsis thaliana [ath]

LisH/CRA/RING-U-box domains-containing protein

No PTMs currently found

PLAZA: AT5G09630
Gene Family: HOM05D002845
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 386

MDVTGTVTVRDAFDRVSKKQKLYHSVTQDVIDLVCDGIQDTLTRIQLGNDDGVEPESVLTELRRKLDALLPIIQLQKSHKETKWSLSKLVKLLEVSYHPDISLACFSVDFDINLVNKILIHHCYREGLFDVGDCLVKEAGREEETEVRSQFLEFHQIVDSLKLRNIEPAMRWIFANRGKLKQKSSKLEFKLLSLKYCDILREGKSDDALEYARTHFTQYPLHFKEIQKLITCLLWIGNFEKSPYAEIVSPSCWDKVTKELIMEYHHLLDQPINSPLKVALSAGYESLPSLLKLVHLMALTKQEWQAMKQLPVPLELGNEYKFHSAFVCPVSRDQSSEENPPMQLPCGHVISKQSMMRLSKNCAFRTFKCPYCPAETLASACRQLYF

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR006594 111 143
IPR006595 150 207
IPR013144 203 296
IPR024964 150 290
IPR027370 328 370
IPR037683 326 375

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here